Revision history of "P02763"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 20:12, 6 April 2021Edwardsnj talk contribs 330 bytes +330 Created page with "{{Protein |accession=P02763 |description=Alpha-1-acid glycoprotein 1 |gene=ORM1 |name=ORM1 |sequence=MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNK..."