Revision history of "P02760"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 03:22, 7 April 2021Edwardsnj talk contribs 468 bytes +468 Created page with "{{Protein |accession=P02760 |description=Protein AMBP |gene=AMBP |name=AMBP |sequence=MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM DRMTVSTLVLGEGATEAEISMTSTRWRK..."