Revision history of "P02751"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 20:02, 6 April 2021Edwardsnj talk contribs 2,626 bytes +2,626 Created page with "{{Protein |accession=P02751 |description=Fibronectin |gene=FN1 |name=FN1 |sequence=MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ INQQWERTYLGNALVCTCYGGSRGFNCESKP..."