P02749

From GPTWiki
Revision as of 15:57, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P02749 |description=Beta-2-glycoprotein 1 |gene=APOH |name=APOH |sequence=MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGG MRKFICPLTGLWPINTLKC...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Beta-2-glycoprotein 1
Gene APOH
Organism Homo sapiens
Species Homo sapiens
GlyGen P02749

Samples (Peptides)

Human Serum (17 / 17)

Sites

N162 (11 / 17), N183 (1 / 17), N253 (5 / 17)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000285155R.VYKPSAGN[H5N4]NSLYR.D167H5N4N1623,108.33910
PE001355155R.VYKPSAGN[H5N4F]NSLYR.D167H5N4FN1623,254.39710
PE001351155R.VYKPSAGN[H5N4FS]NSLYR.D167H5N4FSN1623,545.49320
PE000547155R.VYKPSAGN[H5N4FS2]NSLYR.D167H5N4FS2N1623,836.5882113
PE001354155R.VYKPSAGN[H5N4S]NSLYR.D167H5N4SN1623,399.43540
PE000264155R.VYKPSAGN[H5N4S2]NSLYR.D167H5N4S2N1623,690.5303622
PE001356155R.VYKPSAGN[H6N5FS2]NSLYR.D167H6N5FS2N1624,201.72030
PE000548155R.VYKPSAGN[H6N5FS3]NSLYR.D167H6N5FS3N1624,492.81680
PE001352155R.VYKPSAGN[H6N5S2]NSLYR.D167H6N5S2N1624,055.66241
PE000277155R.VYKPSAGN[H6N5S3]NSLYR.D167H6N5S3N1624,346.758122
PE001044155R.VYKPSAGN[H8N7F]NSLYR.D167H8N7FN1624,349.79410
PE000405180A.MFGN[H6N5F]DTITCTTHGNWTK.L196H6N5FN1834,134.64410
PE000295251K.LGN[H5N4]WSAMPSCK.A261H5N4N2532,890.15121
PE001341251K.LGN[H5N4FS2]WSAMPSCK.A261H5N4FS2N2533,618.39910
PE001368251K.LGN[H5N4S]WSAMPSCK.A261H5N4SN2533,181.2461210
PE001852251K.LGN[H5N4S]WSAM[Ox]PSCK.A261H5N4SN2533,197.24110
PE000522251K.LGN[H5N4S2]WSAMPSCK.A261H5N4S2N2533,472.3412011