Revision history of "P02749"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 15:57, 6 April 2021Edwardsnj talk contribs 470 bytes +470 Created page with "{{Protein |accession=P02749 |description=Beta-2-glycoprotein 1 |gene=APOH |name=APOH |sequence=MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGG MRKFICPLTGLWPINTLKC..."