Revision history of "P01877"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 00:58, 7 April 2021Edwardsnj talk contribs 483 bytes +483 Created page with "{{Protein |accession=P01877 |description=Immunoglobulin heavy constant alpha 2 |gene=IGHA2 |name=IGHA2 |sequence=ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDAS G..."