
From GPTWiki
Revision as of 21:58, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01876 |description=Immunoglobulin heavy constant alpha 1 |gene=IGHA1 |name=IGHA1 |sequence=ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS G...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Immunoglobulin heavy constant alpha 1
Gene IGHA1
Organism Homo sapiens
Species Homo sapiens
GlyGen P01876

Samples (Peptides)

Human Serum (79 / 79)


N144 (52 / 79), N340 (27 / 79)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
... further results