Revision history of "P01876"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 21:58, 6 April 2021Edwardsnj talk contribs 496 bytes +496 Created page with "{{Protein |accession=P01876 |description=Immunoglobulin heavy constant alpha 1 |gene=IGHA1 |name=IGHA1 |sequence=ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS G..."