Revision history of "P01871"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 03:24, 7 April 2021Edwardsnj talk contribs 591 bytes +591 Created page with "{{Protein |accession=P01871 |description=Immunoglobulin heavy constant mu |gene=IGHM |name=IGHM |sequence=GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVL RGGKYAAT..."