
From GPTWiki
Revision as of 23:58, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01861 |description=Immunoglobulin heavy constant gamma 4 |gene=IGHG4 |name=IGHG4 |sequence=ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS G...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Immunoglobulin heavy constant gamma 4
Gene IGHG4
Organism Homo sapiens
Species Homo sapiens
GlyGen P01861

Samples (Peptides)

HEK293 Cells (8 / 24), Human Serum (20 / 24)


N177 (24 / 24)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups