Revision history of "P01861"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 23:58, 6 April 2021Edwardsnj talk contribs 470 bytes +470 Created page with "{{Protein |accession=P01861 |description=Immunoglobulin heavy constant gamma 4 |gene=IGHG4 |name=IGHG4 |sequence=ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS G..."