
From GPTWiki
Revision as of 22:03, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01859 |description=Immunoglobulin heavy constant gamma 2 |gene=IGHG2 |name=IGHG2 |sequence=ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS G...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Immunoglobulin heavy constant gamma 2
Gene IGHG2
Organism Homo sapiens
Species Homo sapiens
GlyGen P01859

Samples (Peptides)

Human Serum (20 / 20)


N176 (20 / 20)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups