Revision history of "P01859"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 22:03, 6 April 2021Edwardsnj talk contribs 469 bytes +469 Created page with "{{Protein |accession=P01859 |description=Immunoglobulin heavy constant gamma 2 |gene=IGHG2 |name=IGHG2 |sequence=ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS G..."