Revision history of "P01857"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 23:21, 6 April 2021Edwardsnj talk contribs 473 bytes +473 Created page with "{{Protein |accession=P01857 |description=Immunoglobulin heavy constant gamma 1 |gene=IGHG1 |name=IGHG1 |sequence=ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS G..."