
From GPTWiki
Revision as of 15:33, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01042 |description=Kininogen-1 |gene=KNG1 |name=KNG1 |sequence=MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT EATKTVGSDTFYSFKYEIKEGDCPVQSGK...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Kininogen-1
Gene KNG1
Organism Homo sapiens
Species Homo sapiens
GlyGen P01042

Samples (Peptides)

Human Serum (26 / 26)


N169 (18 / 26), N205 (5 / 26), N294 (3 / 26)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups