Revision history of "P01042"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 15:33, 6 April 2021Edwardsnj talk contribs 764 bytes +764 Created page with "{{Protein |accession=P01042 |description=Kininogen-1 |gene=KNG1 |name=KNG1 |sequence=MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT EATKTVGSDTFYSFKYEIKEGDCPVQSGK..."