P01033

From GPTWiki
Revision as of 04:29, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01033 |description=Metalloproteinase inhibitor 1 |gene=TIMP1 |name=TIMP1 |sequence=MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR YEIKMTKMY...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Metalloproteinase inhibitor 1
Gene TIMP1
Organism Homo sapiens
Species Homo sapiens
GlyGen P01033

Samples (Peptides)

HEK293 Cells (5 / 5)

Sites

N53 (5 / 5)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00188346K.FVGTPEVN[H4N5F2S]QTTLYQR.Y60H4N5F2SN534,016.71410
PE00218546K.FVGTPEVN[H4N5FS]QTTLYQR.Y60H4N5FSN533,870.65610
PE00219946K.FVGTPEVN[H5N4S2]QTTLYQR.Y60H5N4S2N533,974.66710
PE00220046K.FVGTPEVN[H5N5FS]QTTLYQR.Y60H5N5FSN534,032.70910
PE00190146K.FVGTPEVN[H6N7]QTTLYQR.Y60H6N7N534,163.76710