Revision history of "P01033"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 04:29, 7 April 2021Edwardsnj talk contribs 340 bytes +340 Created page with "{{Protein |accession=P01033 |description=Metalloproteinase inhibitor 1 |gene=TIMP1 |name=TIMP1 |sequence=MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR YEIKMTKMY..."