
From GPTWiki
Revision as of 03:40, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01023 |description=Alpha-2-macroglobulin |gene=A2M |name=A2M |sequence=MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV SASLESVRGNRSLFTDLEAEN...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Alpha-2-macroglobulin
Gene A2M
Organism Homo sapiens
Species Homo sapiens
GlyGen P01023

Samples (Peptides)

Human Serum (36 / 36)


N55 (4 / 36), N247 (2 / 36), N869 (12 / 36), N1424 (18 / 36)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups