Revision history of "P01023"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 02:40, 7 April 2021Edwardsnj talk contribs 1,616 bytes +1,616 Created page with "{{Protein |accession=P01023 |description=Alpha-2-macroglobulin |gene=A2M |name=A2M |sequence=MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV SASLESVRGNRSLFTDLEAEN..."