
From GPTWiki
Revision as of 01:46, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01011 |description=Alpha-1-antichymotrypsin |gene=SERPINA3 |name=SERPINA3 |sequence=MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL YKQLVLKA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Alpha-1-antichymotrypsin
Organism Homo sapiens
Species Homo sapiens
GlyGen P01011

Samples (Peptides)

Human Serum (29 / 29)


N93 (4 / 29), N106 (8 / 29), N127 (4 / 29), N271 (13 / 29)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups