Revision history of "P01011"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 00:46, 7 April 2021Edwardsnj talk contribs 561 bytes +561 Created page with "{{Protein |accession=P01011 |description=Alpha-1-antichymotrypsin |gene=SERPINA3 |name=SERPINA3 |sequence=MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL YKQLVLKA..."