
From GPTWiki
Revision as of 13:52, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01009 |description=Alpha-1-antitrypsin |gene=SERPINA1 |name=SERPINA1 |sequence=MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS LYRQLAHQSNSTN...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Alpha-1-antitrypsin
Organism Homo sapiens
Species Homo sapiens
GlyGen P01009

Samples (Peptides)

Human Serum (42 / 42)


N70 (7 / 42), N107 (18 / 42), N271 (17 / 42)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups