Revision history of "P01009"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 13:52, 6 April 2021Edwardsnj talk contribs 550 bytes +550 Created page with "{{Protein |accession=P01009 |description=Alpha-1-antitrypsin |gene=SERPINA1 |name=SERPINA1 |sequence=MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFS LYRQLAHQSNSTN..."