
From GPTWiki
Revision as of 00:14, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P01008 |description=Antithrombin-III |gene=SERPINC1 |name=SERPINC1 |sequence=MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEK KATEDEGSEQKIPEAT...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Antithrombin-III
Organism Homo sapiens
Species Homo sapiens
GlyGen P01008

Samples (Peptides)

Human Serum (15 / 15)


N128 (9 / 15), N187 (4 / 15), N224 (2 / 15)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups