Revision history of "P01008"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 23:14, 6 April 2021Edwardsnj talk contribs 594 bytes +594 Created page with "{{Protein |accession=P01008 |description=Antithrombin-III |gene=SERPINC1 |name=SERPINC1 |sequence=MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEK KATEDEGSEQKIPEAT..."