P00751

From GPTWiki
Revision as of 03:29, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00751 |description=Complement factor B |gene=CFB |name=CFB |sequence=MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY VCPSGFYPYPVQTRTCRSTGSWS...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement factor B
Gene CFB
Organism Homo sapiens
Species Homo sapiens
GlyGen P00751

Samples (Peptides)

Human Serum (5 / 5)

Sites

N122 (2 / 5), N285 (1 / 5), N378 (2 / 5)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000681118R.SPYYN[H5N4S]VSDEISFHCYDGYTLR.G138H5N4SN1224,516.80431
PE000654118R.SPYYN[H5N4S2]VSDEISFHCYDGYTLR.G138H5N4S2N1224,807.90051
PE000102261K.IVLDPSGSMNIYLVLDGSDSIGASN[H5N4S2]FTGAK.K290H5N4S2N2855,263.28930
PE000110357K.KALQAVYSMMSWPDDVPPEGWN[H5N4FS2]R.T379H5N4FS2N3785,045.08710
PE000416357K.KALQAVYSMMSWPDDVPPEGWN[H5N4S2]R.T379H5N4S2N3784,899.02950