Revision history of "P00751"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 03:29, 7 April 2021Edwardsnj talk contribs 892 bytes +892 Created page with "{{Protein |accession=P00751 |description=Complement factor B |gene=CFB |name=CFB |sequence=MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY VCPSGFYPYPVQTRTCRSTGSWS..."