P00747

From GPTWiki
Revision as of 14:36, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00747 |description=Plasminogen |gene=PLG |name=PLG |sequence=MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT CRAFQYHSKEQQCVIMAENRKSSIIIRMRDV...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Plasminogen
Gene PLG
Organism Homo sapiens
Species Homo sapiens
GlyGen P00747

Samples (Peptides)

Human Serum (2 / 2)

Sites

N308 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001421285R.GNVAVTVSGHTCQHWSAQTPHTHN[H5N4S]R.T309H5N4SN3084,712.97810
PE001279285R.GNVAVTVSGHTCQHWSAQTPHTHN[H5N4S2]R.T309H5N4S2N3085,004.07361