Revision history of "P00747"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 14:36, 6 April 2021Edwardsnj talk contribs 931 bytes +931 Created page with "{{Protein |accession=P00747 |description=Plasminogen |gene=PLG |name=PLG |sequence=MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT CRAFQYHSKEQQCVIMAENRKSSIIIRMRDV..."