
From GPTWiki
Revision as of 16:39, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00738 |description=Haptoglobin |gene=HP |name=HP |sequence=MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRT EGDGVYTLNDKKQWINKAVGDKLPECEADDGCP...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Haptoglobin
Gene HP
Organism Homo sapiens
Species Homo sapiens
GlyGen P00738

Samples (Peptides)

Human Serum (53 / 53)


N184 (28 / 53), N207 (2 / 53), N241 (23 / 53)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
... further results