Revision history of "P00738"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 17:39, 6 April 2021Edwardsnj talk contribs 518 bytes +518 Created page with "{{Protein |accession=P00738 |description=Haptoglobin |gene=HP |name=HP |sequence=MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRT EGDGVYTLNDKKQWINKAVGDKLPECEADDGCP..."