P00736

From GPTWiki
Revision as of 14:39, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00736 |description=Complement C1r subcomponent |gene=C1R |name=C1R |sequence=MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF QQFDLEPSEGCFYDY...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement C1r subcomponent
Gene C1R
Organism Homo sapiens
Species Homo sapiens
GlyGen P00736

Samples (Peptides)

Human Serum (1 / 1)

Sites

N514 (1 / 1)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE000638508K.EHEAQSN[H5N4S2]ASLDVFLGHTNVEELMK.L531H5N4S2N5144,920.05340