Revision history of "P00736"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 14:39, 6 April 2021Edwardsnj talk contribs 840 bytes +840 Created page with "{{Protein |accession=P00736 |description=Complement C1r subcomponent |gene=C1R |name=C1R |sequence=MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF QQFDLEPSEGCFYDY..."