P00734@N416

From GPTWiki
Revision as of 20:31, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=416 |protein=P00734 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein F2 (P00734)
Site N416
GlyGen P00734@N416

Samples (Peptides)

Human Serum (4 / 4)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000457400R.WVLTAAHCLLYPPWDKN[H5N4S]FTENDLLVR.I425H5N4S5,102.28951
PE001836385K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I425H5N4S27,020.18810
PE000240400R.WVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I425H5N4S25,393.3841411
PE000598416K.N[H5N4S2]FTENDLLVR.I425H5N4S23,442.40332