
From GPTWiki
Revision as of 16:46, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00734 |description=Prothrombin |gene=F2 |name=F2 |sequence=MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC VEETCSYEEAFEALESSTATDVFWAKYTACETA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Prothrombin
Gene F2
Organism Homo sapiens
Species Homo sapiens
GlyGen P00734

Samples (Peptides)

Human Serum (10 / 10)


N121 (1 / 10), N143 (5 / 10), N416 (4 / 10)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups