Revision history of "P00734"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 17:46, 6 April 2021Edwardsnj talk contribs 738 bytes +738 Created page with "{{Protein |accession=P00734 |description=Prothrombin |gene=F2 |name=F2 |sequence=MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC VEETCSYEEAFEALESSTATDVFWAKYTACETA..."