
From GPTWiki
Revision as of 02:09, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=P00450 |description=Ceruloplasmin |gene=CP |name=CP |sequence=MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP DRIGRLYKKALYLQYTDETFRTTIEKPVWLG...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Ceruloplasmin
Gene CP
Organism Homo sapiens
Species Homo sapiens
GlyGen P00450

Samples (Peptides)

Human Serum (40 / 40)


N138 (12 / 40), N358 (2 / 40), N397 (7 / 40), N762 (19 / 40)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups