Revision history of "P00450"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 02:09, 7 April 2021Edwardsnj talk contribs 1,190 bytes +1,190 Created page with "{{Protein |accession=P00450 |description=Ceruloplasmin |gene=CP |name=CP |sequence=MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP DRIGRLYKKALYLQYTDETFRTTIEKPVWLG..."