Revision history of "O95445"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 16:17, 6 April 2021Edwardsnj talk contribs 306 bytes +306 Created page with "{{Protein |accession=O95445 |description=Apolipoprotein M |gene=APOM |name=APOM |sequence=MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEEL ATFDPVDNIVFNMAAGSAPMQLHL..."