Revision history of "O95302"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 00:53, 7 April 2021Edwardsnj talk contribs 721 bytes +721 Created page with "{{Protein |accession=O95302 |description=Peptidyl-prolyl cis-trans isomerase FKBP9 |gene=FKBP9 |name=FKBP9 |sequence=MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVR..."