O43852

From GPTWiki
Revision as of 18:28, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=O43852 |description=Calumenin |gene=CALU |name=CALU |sequence=MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT FDQLTPEESKERLGKIVSKIDGDKDGFVTVD...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Calumenin
Gene CALU
Organism Homo sapiens
Species Homo sapiens
GlyGen O43852

Samples (Peptides)

HEK293 Cells (2 / 2)

Sites

N131 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001256115K.GHDLNEDGLVSWEEYKN[H3N4F]ATYGYVLDDPDPDDGFNYK.Q150H3N4FN1315,612.34710
PE002179115K.GHDLNEDGLVSWEEYKN[H3N5F]ATYGYVLDDPDPDDGFNYK.Q150H3N5FN1315,815.42710