Revision history of "O43852"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 18:28, 6 April 2021Edwardsnj talk contribs 428 bytes +428 Created page with "{{Protein |accession=O43852 |description=Calumenin |gene=CALU |name=CALU |sequence=MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT FDQLTPEESKERLGKIVSKIDGDKDGFVTVD..."