Revision history of "O43405"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 11:27, 8 May 2021Edwardsnj talk contribs 665 bytes +665 Created page with "{{Protein |accession=O43405 |description=Cochlin |gene=COCH |name=COCH |sequence=MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFS VYGNIVYASVSSICGAAVHRGVISNSGGPVRVY..."