G98596OT

From GPTWiki
Revision as of 18:57, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G98596OT |class=N-Glycan |mw=2937.0524822 |name=H6N6FS2 HexNAc(6)Hex(6)Fuc(1)NeuAc(2) HexNAc(6)Hex(6)dHex(1)NeuAc(2) |nneuac=2 |sym=H6N6FS2 |topo=G16737QE,...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H6N6FS2
HexNAc(6)Hex(6)Fuc(1)NeuAc(2)
HexNAc(6)Hex(6)dHex(1)NeuAc(2)
Molecular Weight 2937.0524822
Class(es) N-Glycan
GlyGen

G98596OT

GNOme

G98596OT

Topologies

Samples (Peptides)

Human Serum (1 / 3), SARS-CoV-2 Spike Protein (2 / 3)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001163R.LAGKPTHVN[H6N6FS2]VSVVMAEVDGTCY.-5,283.187P01876N34010
PE001642K.VCEFQFCNDPFLGVYYHKNN[H6N6FS2]K.S5,615.257P0DTC2N14910
PE001557K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS2]FTTAPAICHDGK.A7,488.278P0DTC2N107420