G86752LQ

From GPTWiki
Revision as of 01:55, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G86752LQ |class=N-Glycan |mw=2442.8776931 |name=H6N5FS HexNAc(5)Hex(6)Fuc(1)NeuAc(1) HexNAc(5)Hex(6)dHex(1)NeuAc(1) |nneuac=1 |sym=H6N5FS |topo=G19992GW,G4...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H6N5FS
HexNAc(5)Hex(6)Fuc(1)NeuAc(1)
HexNAc(5)Hex(6)dHex(1)NeuAc(1)
Molecular Weight 2442.8776931
Class(es) N-Glycan
GlyGen

G86752LQ

GNOme

G86752LQ

Topologies

Samples (Peptides)

Human Serum (8 / 11), SARS-CoV-2 Spike Protein (3 / 11)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001135K.EHEGAIYPDN[H6N5FS]TTDFQR.A4,334.711P00450N13820
PE001136K.ELHHLQEQN[H6N5FS]VSNAFLDKGEFYIGSK.Y5,345.303P00450N76210
PE001167K.ELHHLQEQN[H6N5FS]VSNAFLDK.G4,463.874P00450N76210
PE001386K.MVSHHN[H6N5FS]LTTGATLINEQWLLTTAK.N5,121.263P00738N18410
PE001140R.HGIQYFNN[H6N5FS]NTQHSSLFMLNEVK.R5,063.127P01042N16910
PE001872R.LAGKPTHVN[H6N5FS]VSVVMAEVDGTCY.-4,789.012P01876N34010
PE001154R.ADGTVNQIEGEATPVN[H6N5FS]LTEPAKLEVK.F5,165.280P05090N9820
PE001490K.DFGGFN[H6N5FS]FSQILPDPSKPSKR.S4,679.005P0DTC2N80110
PE001618K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS]FTTAPAICHDGK.A6,994.103P0DTC2N107420
PE001536R.EGVFVSN[H6N5FS]GTHWFVTQR.N4,305.784P0DTC2N109820
PE001229K.LHINHNN[H6N5FS]LTESVGPLPK.S4,324.884P51884N12720