G73686WG

From GPTWiki
Revision as of 01:33, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G73686WG |class=N-Glycan |mw=2808.00989034 |name=H7N6FS FA4G4S A4G4FS HexNAc(6)Hex(7)dHex(1)NeuAc(1) HexNAc(6)Hex(7)Fuc(1)NeuAc(1) |nneuac=1 |sym=H7N6FS |t...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H7N6FS
FA4G4S
A4G4FS
HexNAc(6)Hex(7)dHex(1)NeuAc(1)
HexNAc(6)Hex(7)Fuc(1)NeuAc(1)
Molecular Weight 2808.00989034
Class(es) N-Glycan
GlyGen

G73686WG

GNOme

G73686WG

Topologies

Samples (Peptides)

HEK293 Cells (1 / 2), SARS-CoV-2 Spike Protein (1 / 2)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001656K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A7,359.236P0DTC2N107460
PE001913K.VASVININPN[H7N6FS]TTHSTGSCR.S4,834.995P13473N25710