G69364JQ

From GPTWiki
Revision as of 04:45, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G69364JQ |class=N-Glycan |mw=2192.8088257 |name=H5N6F HexNAc(6)Hex(5)Fuc(1) HexNAc(6)Hex(5)dHex(1) |nneuac=0 |sym=H5N6F |topo=G17140MC,G37127GQ,G64424PR,G6...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H5N6F
HexNAc(6)Hex(5)Fuc(1)
HexNAc(6)Hex(5)dHex(1)
Molecular Weight 2192.8088257
Class(es) N-Glycan
GlyGen

G69364JQ

GNOme

G69364JQ

Topologies

Samples (Peptides)

SARS-CoV-2 Spike Protein (3 / 3)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001639K.VCEFQFCNDPFLGVYYHKNN[H5N6F]K.S4,871.013P0DTC2N14910
PE001551K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H5N6F]FTTAPAICHDGK.A6,744.034P0DTC2N107420
PE001529R.EGVFVSN[H5N6F]GTHWFVTQR.N4,055.715P0DTC2N109810