G67367OT

From GPTWiki
Revision as of 06:07, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G67367OT |class=N-Glycan |mw=2071.78255231 |name=H3N7F FA4B A4BF1 HexNAc(7)Hex(3)dHex(1) HexNAc(7)Hex(3)Fuc(1) |nneuac=0 |sym=H3N7F |topo=G29362FG,G75337UB...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H3N7F
FA4B
A4BF1
HexNAc(7)Hex(3)dHex(1)
HexNAc(7)Hex(3)Fuc(1)
Molecular Weight 2071.78255231
Class(es) N-Glycan
GlyGen

G67367OT

GNOme

G67367OT

Topologies

Samples (Peptides)

SARS-CoV-2 Spike Protein (2 / 2)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE002183K.TQSLLIVNN[H3N7F]ATNVVIK.V3,797.781P0DTC2N12210
PE001655K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N7F]FTTAPAICHDGK.A6,623.008P0DTC2N107410