G55382TU

From GPTWiki
Revision as of 23:38, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Glycan |accession=G55382TU |class=N-Glycan |mw=1868.7031797 |name=H3N6F FA4 A4F1 HexNAc(6)Hex(3)dHex(1) HexNAc(6)Hex(3)Fuc(1) |nneuac=0 |sym=H3N6F |topo=G86536RG,G45362LV,G7...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Name(s) H3N6F
FA4
A4F1
HexNAc(6)Hex(3)dHex(1)
HexNAc(6)Hex(3)Fuc(1)
Molecular Weight 1868.7031797
Class(es) N-Glycan
GlyGen

G55382TU

GNOme

G55382TU

Topologies

Samples (Peptides)

Human ACE2 Protein (1 / 5), SARS-CoV-2 Spike Protein (4 / 5)

Peptides

 PeptideMol. Wt.ProteinSiteTrans. GroupsDIA Trans. Groups
PE001660K.TQSLLIVNN[H3N6F]ATNVVIK.V3,594.702P0DTC2N12220
PE001662K.VCEFQFCNDPFLGVYYHKNN[H3N6F]K.S4,546.908P0DTC2N14910
PE001654K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H3N6F]FTTAPAICHDGK.A6,419.929P0DTC2N107430
PE001661R.EGVFVSN[H3N6F]GTHWFVTQR.N3,731.610P0DTC2N109810
PE001797K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N6F]ITEENVQNMNNAGDKWSAFLK.E7,512.299Q9BYF1N5310